OuterStats is here to display any thing is needed for www.affiliatemarketingsecretsreveal.com. We seek and locate Affiliatemarketingsecretsreveal.com information for inquirer. We will show you Affiliatemarketingsecretsreveal value, date of creation, location, hosted server, local language and estimated data - The estimated data is a special algorithm built by us to demonstrate www.affiliatemarketingsecretsreveal.com worth.

Affiliate Marketing Secrets Reveal | Affiliate Marketing Success

Affiliate Marketing Secrets Reveal gives you the latest updates on affiliate marketing success, learning affiliate marketing, affiliate marketing for beginners,

Affiliatemarketingsecretsreveal.com was created on the 2015-12-17, domain is hosted in ip:, and owner of this ips: UNIFIEDLAYER-NETWORK-9 . Affiliatemarketingsecretsreveal.com using nginx/1.12.0 server and powered by unknown.

Created: 17/12/2015

Expires: 17/12/2017

Hosted in: United States

Host IP:

ICANN Registrar: ENOM, INC.

Domain Archive: affiliatemarketingsecretsreveal.com in the past

Alexa Rank: #0

Google Page Rank: 0

Server DNS A:

Server DNS NS: ns4001.hostgator.com ns4002.hostgator.com

Server Name: unavailable

Server Type: nginx/1.12.0

Server Side Language: unavailable

affiliatemarketingsecretsreveal.com - Daily Traffic Rank Trend In The Past 4 Months

Keyword Count Density
Ezine 55 2.1
Affiliate 36 1.37
Marketing 32 1.22
Own 28 1.07
Mailing 21 0.8
Publishing 18 0.69
Money 17 0.65
Success 17 0.65
Subscribers 15 0.57
Product 14 0.53
Often 11 0.42
Newsletter 11 0.42
Blogging 10 0.38
Advertising 9 0.34
Selling 9 0.34
Business 9 0.34
Than 9 0.34
Format 8 0.31
Demand 7 0.27
Writing 7 0.27
Space 7 0.27
Header Key Header Value
Server nginx/1.12.0
Date Sun, 28 May 2017 16:40:15 GMT
Content-Type text/html; charset=UTF-8
Transfer-Encoding chunked
Connection keep-alive
Link ; rel="https://api.w.org/"


Server Country Code: US

Server Country Name: United States

Server City Name: Provo

Server Region Name: UT

Server Zip Code: 84606

Server Latitude: 40.218101501465

Server Longitude: -111.61329650879

Server location

lffiliatemarketingsecretsreveal.com, affimiatemarketingsecretsreveal.com, affiziatemarketingsecretsreveal.com, affiliatemmrketingsecretsreveal.com, affiliatemaruetingsecretsreveal.com, affiliatemarkegingsecretsreveal.com, affiliatemarkemingsecretsreveal.com, affiliatemarkeqingsecretsreveal.com, affiliatemarketngsecretsreveal.com, affiliatemarketingseeretsreveal.com, affiliatemarketingsecmetsreveal.com, affiliatemarketingsecrbtsreveal.com, affiliatemarketingsecrejsreveal.com, affiliatemarketingsecrensreveal.com, affiliatemarketingsecretsleveal.com, affiliatemarketingsecretspeveal.com, affiliatemarketingsecretsqeveal.com, affiliatemarketingsecretsrevoal.com, affiliatemarketingsecretsrevqal.com, affiliatemarketingsecretsrevtal.com, affiliatemarketingsecretsreveag.com, affiliatemarketingsecretsrevealrcom, affiliatemarketingsecretsreveal.czm, affiliatemarketingsecertsreveal.com, affiliyatemarketingsecretsreveal.com, affiliadtemarketingsecretsreveal.com, affiliattemarketingsecretsreveal.com, affiliatemgarketingsecretsreveal.com, affiliatemlarketingsecretsreveal.com, affiliatemaroketingsecretsreveal.com, affiliatemarsketingsecretsreveal.com, affiliatemarkeptingsecretsreveal.com, affiliatemarkeytingsecretsreveal.com, affiliatemarkethingsecretsreveal.com, affiliatemarketinvgsecretsreveal.com, affiliatemarketingtsecretsreveal.com, affiliatemarketingsqecretsreveal.com, affiliatemarketingseocretsreveal.com, affiliatemarketingsecretsfreveal.com, affiliatemarketingsecretsreaveal.com, affiliatemarketingsecretsreqveal.com, affiliatemarketingsecretsrevneal.com, affiliatemarketingsecretsrevueal.com, affiliatemarketingsecretsrevejal.com, affiliatemarketingsecretsreveaal.com, affiliatemarketingsecretsreveal.acom, affiliatemarketingsecretsreveal.ccom, affiliatemarketingsecretsreveal.crom, affiliatemarketingsecretsreveal.corm, affiliatemarketingsecretsreveal.coum

Registry Domain ID: 1987908167_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2016-11-15T21:55:35.00Z
Creation Date: 2015-12-17T08:12:00.00Z
Registrar Registration Expiration Date: 2017-12-17T08:12:44.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Organization: WHOISGUARD, INC.
Registrant Street: P.O. BOX 0823-03411
Registrant City: PANAMA
Registrant State/Province: PANAMA
Registrant Postal Code: 00000
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: AB069525D5614142BC281D9A39A5A329.******
Registry Admin ID:
Admin Organization: WHOISGUARD, INC.
Admin Street: P.O. BOX 0823-03411
Admin City: PANAMA
Admin State/Province: PANAMA
Admin Postal Code: 00000
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: AB069525D5614142BC281D9A39A5A329.******
Registry Tech ID:
Tech Organization: WHOISGUARD, INC.
Tech Street: P.O. BOX 0823-03411
Tech City: PANAMA
Tech State/Province: PANAMA
Tech Postal Code: 00000
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: AB069525D5614142BC281D9A39A5A329.******
Name Server: NS4001.HOSTGATOR.COM
Name Server: NS4002.HOSTGATOR.COM
DNSSEC: unSigned
Registrar Abuse Contact Email: ******
Registrar Abuse Contact Phone: +1.4252982646
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2016-11-15T21:55:35.00Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available "as is," and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.

We reserve the right to modify these terms at any time. By submitting
this query, you agree to abide by these terms.
Version 6.3 4/3/2002

Recent Analyzed Websites

Recent Visited Websites